A meal with high nutritional value, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
ID
219754
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
A meal with high nutritional value, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Salmon, Beetroot and Citrus Sashimi Platter, a highly nutritious meal, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, traditional popular Arab dishes, delicious, healthy and tasty food recipes
Delicious scallops fried in a pan with balsamic sauce, a meal with high nutritional value, the arts of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and delicious food recipes
Delicious scallops fried in a pan with balsamic sauce, a meal with high nutritional value, the arts of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and delicious food recipes
Traditional lunch recipes in Saudi Arabia restaurants, a dish of grilled eggplant with vegetables, famous foods and dishes in Saudi cuisine, healthy vegetable meals rich in vitamins
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Similar Photos
View moreSimilar Photos
Delicious sea oyster dish, mussels, aquatic shell animals, seafood, Arabic restaurants
A dish of crab soup, healthy meals, hot dishes, delicious crab dishes, seafood
A meal with high nutritional value, a bunch of healthy, blonde dates, Deglet Nour dates, traditional Ramadan hospitality, luxurious types of dates in the Kingdom of Saudi Arabia, national local agricultural fruits and crops, white background
Traditional Ramadan hospitality, distinct types of dates, a meal with high nutritional value of blonde Saqqi dates isolated on a white background
Fresh seafood and seafood in Dubai markets, professional fishing in the United Arab Emirates, healthy and fresh fish, nutritional benefits of fish, fish market in the Deira area in Dubai in the Emirates, seafood rich in protein
Nutritional benefits of fish, fish market in the Deira area, seafood rich in protein, fresh seafood and seafood in Dubai markets, professional fishing in the United Arab Emirates, healthy and fresh fish
A pile of oysters at the fish market in Deira, Dubai, UAE. Nutritional benefits of fish. Healthy and fresh seafood. Marine nature reserve. The concept of self-sufficiency from marine wealth. Food items rich in protein and other nutrients.
Enjoy a healthy breakfast, delicious meals, a table of the most delicious foods in a high-end restaurant, delicious healthy dishes, restaurants serving Arabic and Western cuisine in the United Arab Emirates, foods with high nutritional value
Similar Vectors
View moreSimilar Vectors
Eastern Arab food, phrases and texts in Arabic calligraphy, potato manuscript in Arabic, yellow background, vector Illustrator
A plate of fresh healthy sugar dates with a copper kettle and cups, Saudi national local agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, delicious Saudi coffee, delicious dates, white background, vector illustrator
Dates, brown Arabic manuscript, local national agricultural products and crops, delicious fresh fruits, high nutritional value food, healthy sugar dates, blue background, vector illustrator
High nutritional value meal, logo for fresh healthy sugar dates, Saudi national local agricultural product and crop, delicious Ramadan hospitality, delicious dates, yellow background, vector illustrator
Icons of fresh healthy sugar dates, a Saudi national local agricultural crop and product, a meal with high nutritional value, a delicious Ramadan hospitality, delicious dates, white background, vector illustrator
The joy of preparing delicious recipes, a cartoon of a veiled Saudi Arabian Gulf woman preparing salads, vegetables and healthy dishes, professional cooking, food presentation and decoration skills, vector illustrator
Saudi national local agricultural crop and product, veiled Saudi Arabian Gulf woman wearing abaya holding a plate of fresh healthy sugary dates, delicious Ramadan hospitality, high nutritional value meal, delicious dates, white background, vector illustrator
A welcoming gesture from the chef, the chef's special attire, a cartoon drawing of a smiling Arab chef presenting a steak on a plate in a professional manner, isolated, white background, vector illustration.
Similar Videos
View more
Keywords
healthyeasternpopularphotopictureseadecoratedrestaurantsdinnerfoodlunchmealrestaurantartisticdishcookingdeliciouskitcheneatingmealsbowldishespresentationvegetablescreaturesfastfoodsmethodsrichvesselspeciesfreshingredientsreciperecipeslifestyledietobjectstastytypesfattykitchenspiecemostappetizersappetizernutritionsaltymineralsproteinvitaminshealthy foodseafoodshrimpoysterskingdomsaudi arabiasauditraditionalarabicarrangedartartsdistinctivefast foodappetizinghealthy mealsmouldarab foodfast mealpresentation artseastern restaurantssystem fooddesirable dishesdesirable foodsassorted dishhuge dishmost typesvaried shapes
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.