A plate of grilled artichoke hearts with tomato sauce, delicious oriental Arabic cuisine, fast food restaurants, recipes and distinctive dishes in the kitchens of the Kingdom of Saudi Arabia, healthy foods and foods
ID
219756
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
A plate of grilled artichoke hearts with tomato sauce, delicious oriental Arabic cuisine, fast food restaurants, recipes and distinctive dishes in the kitchens of the Kingdom of Saudi Arabia, healthy foods and foods
The art of presenting and decorating food in the oriental style, a plate of cheese and meat with fruits, light and healthy snacks rich in important nutrients, a Saudi breakfast, luxury restaurants in the Kingdom of Saudi Arabia
Artistic methods of presenting fresh vegetables, fruits and cheeses, local Saudi national agricultural products and crops, a wooden plate filled with various and different types of delicious foods, snacks and light meals, foods rich in vitamins and important nutrients
Recipes for grilled meat with various flavors, restaurants for oriental Arab cuisine, a delicious plate of steaks, cherries and wild rice, healthy foods and foods, delicious hot lamb meals, presentation arts in the kitchens of the Kingdom of Saudi Arabia
A meal with high nutritional value, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Delicious Arabic food and meals, a meal with high nutritional value, a close-up photo of a plate of delicious lasagna with cheese, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia
Similar Photos
View moreSimilar Photos
Close-up of a plate of delicious shrimp depicted on a green background, a plate of seafood, delicious meals, chroma, delicious food, arabic restaurants, delicious seafood, recipes for delicious dishes
A group of shrimp cups, seafood, seafood dishes, delicious meals, seafood restaurant, innovative presentation method
A healthy nutritional meal, a group of frozen shrimp ready for sale, fresh seafood, white meat, and different types of fish.
Professional fishing in the United Arab Emirates, shrimp in fish stores, a close-up of giant tiger shrimp in Al Jibal Market in Sharjah, fresh seafood and creatures.
Traditional Ramadan hospitality, distinct types of dates, a meal with high nutritional value of blonde Saqqi dates isolated on a white background
A pile of oysters at the fish market in Deira, Dubai, UAE. Nutritional benefits of fish. Healthy and fresh seafood. Marine nature reserve. The concept of self-sufficiency from marine wealth. Food items rich in protein and other nutrients.
Enjoy a healthy breakfast, delicious meals, a table of the most delicious foods in a high-end restaurant, delicious healthy dishes, restaurants serving Arabic and Western cuisine in the United Arab Emirates, foods with high nutritional value
Nutritious and filling breakfast meals, the art of serving dishes in Saudi restaurants, mastering the skill of preparing pastries in the Kingdom's kitchens, a plate of delicious, healthy baked pies, delicious borek recipes, using crispy pastry sheets, and local, national products and foods.
Similar Vectors
View moreSimilar Vectors
Linear vector icons for different types of food, fish, chicken, meat, ready-made icons and templates, vector illustrator
Eastern Arab food, phrases and texts in Arabic calligraphy, potato manuscript in Arabic, yellow background, vector Illustrator
Writing in authentic Arabic calligraphy, a logo for the name of a fish restaurant in Arabic, phrases and texts for oriental Arabic food, blue background, vector Illustrator
High nutritional value meal, close up of plate of fresh healthy sugar dates with palm leaves, Saudi national local agricultural crops and products, delicious Ramadan hospitality, delicious dates, white background, vector illustrator
High nutritional value meal, logo for fresh healthy sugar dates, Saudi national local agricultural product and crop, delicious Ramadan hospitality, delicious dates, yellow background, vector illustrator
The joy of preparing delicious recipes, a cartoon of a veiled Saudi Arabian Gulf woman preparing salads, vegetables and healthy dishes, professional cooking, food presentation and decoration skills, vector illustrator
Saudi national local agricultural crop and product, veiled Saudi Arabian Gulf woman wearing abaya holding a plate of fresh healthy sugary dates, delicious Ramadan hospitality, high nutritional value meal, delicious dates, white background, vector illustrator
A welcoming gesture from the chef, the chef's special attire, a cartoon drawing of a smiling Arab chef presenting a steak on a plate in a professional manner, isolated, white background, vector illustration.
Similar Videos
View more
Keywords
healthyeasternpopularphotopictureseadecoratedrestaurantsdinnerfoodlunchmealrestaurantartisticdishcookingdeliciouskitcheneatingmealsbowldishespresentationvegetablescreaturesfastfoodsmethodsrichvesselspeciesfreshingredientsreciperecipeslifestyledietobjectstastytypesfattykitchenspiecemostappetizersappetizernutritionsaltymineralsproteinvitaminshealthy foodseafoodshrimpoysterskingdomsaudi arabiasauditraditionalarabicarrangedartartsdistinctivefast foodappetizinghealthy mealsmouldarab foodfast mealpresentation artseastern restaurantssystem fooddesirable dishesdesirable foodsassorted dishhuge dishmost typesvaried shapes
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.