Taking selfies, using technology, close-up side view of a veiled Emirati Gulf Arab woman wearing an abaya using a mobile phone with cold gestures, making a video call on the mobile, wearing winter clothes, white background
0:11
ID
405805
Enjoying and savoring a hot drink in the cold winter weather, the necessity of drinking plenty of fluids in the winter, gestures indicating extreme cold, feeling frostbite, chills and freezing, a close-up of a veiled Emirati Gulf Arab woman wearing an abaya drinking a cup of coffee, white background
Recommended audios for this video
Similar Photos
Portrait of a Saudi Arabian Gulf man wearing warm winter clothes and holding a cup of hot drink in his hand, wearing a winter jacket, feeling frosty, warm winter drinks, face and hands gestures indicating extreme cold, winter atmosphere, white background
Two young Saudi Arabian Gulf men enjoying a wild camping trip, wearing warm winter clothes, serving hot tea to guests, good hospitality and reception, friendship and acquaintance, dialogues and discussions between friends, a popular Arab charitable sessio
Gulf Saudi Arab friends enjoying a wild trip in the desert, offering fruits to guests, hospitality and reception, a popular Arab session, popular tents in the deserts of Saudi Arabia, a youthful burial kashta
Good generosity and hospitality, pouring tea for the guests, quiet sitting in the wilderness in front of the fireplace, enjoying hot drinks in the winter atmosphere, a close-up picture of two Saudi Gulf Arab men wearing the traditional thobe and shemagh with warm winter clothes spending enjoyable times, a youthful bar kashta
Maintaining the health of the body’s immune system, feeling thirsty and dehydrated, close-up portrait of an Emirati Gulf Arab man wearing a white fur and ghutra, drinking water from a small plastic bottle, continuing to drink water, cold winter weather, white background
Culinary art of oriental Arabic cuisine, close-up of a plate of white rice with vegetables and cooked meat pieces, protein-rich foods, traditional recipes popular in Saudi Arabia restaurants, popular meals and dishes
Similar Vectors
Vector icon car, cloud and sun, weather forecast, weather, vector illustrator
Vector village covered with snow in winter, snow mountain, landscape, vector illustrator.
Vector house in winter, snow mountain, landscape, vector illustrator.
Vector house in winter, snow, landscape, vector illustrator.
حفظ الترجمة Vector design of linear icons for a coffee drink, coffee icons, pattern cups icons, various graphics, vector illustrator
Vector design of linear icons for a coffee drink, coffee icons, pattern cups icons, various graphics, white background, vector illustrator
Keywords
whitebodyclotheswearyoungladywomanweatherhardatmosphereclimatewinterhathandseatsignsheatseasoncoffeecupdrinkscoldhotfallcoatwarmheavydrinkwarmthteafatiguetiredexhaustiondropchangesappropriateemiratesmugbreezeschangeclimaticconditionsfreezefrozenharshicemeteorologypolarstingspamperingcoolseasonsemiratiseveregesturefrostchillsshiveringdobackgroundexpressionsfacegestureshandarabicclose-upenjoymentfeelinggulfoccasionyoung womangirlfemalecolorfulrunny nosedroopingwinter atmospherewarmingfreezingclose-up photographyemirati womanatmosphere winterwinterysevere coldcold intensewhite background
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.