Delicious oriental dessert, making and preparing sweets, close-up of a group of chocolate balls with different flavors on a white plate, serving sweets on occasions and holidays, delicious brown and white chocolate
ID
219760
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
Delicious oriental dessert, making and preparing sweets, close-up of a group of chocolate balls with different flavors on a white plate, serving sweets on occasions and holidays, delicious brown and white chocolate
Grilled salmon with lemon and celery sauce, a meal with high nutritional value, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Delicious Arabic food and meals, a meal with high nutritional value, a close-up photo of a plate of delicious lasagna with cheese, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia
Grilled steak with rosemary and spices, healthy lamb meals, delicious oriental Arabic cuisine, fast food restaurants, recipes and distinctive dishes in the kitchens of the Kingdom of Saudi Arabia
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Seafood Risotto with Mussels and Shrimp, a highly nutritious meal, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Similar Photos
View moreSimilar Photos
Close-up of a plate of delicious shrimp depicted on a green background, a plate of seafood, delicious meals, chroma, delicious food, arabic restaurants, delicious seafood, recipes for delicious dishes
Plates of healthy dates, a meal with a high nutritional value, Ramadan hospitality, types of healthy and delicious dates, white background
A dish of crab soup, healthy meals, hot dishes, delicious crab dishes, seafood
Close-up of a plate of healthy diabetes dates, a meal with a high nutritional value, Ramadan hospitality, types of healthy and delicious dates, white background
Professional fishing in the United Arab Emirates, shrimp in fish stores, a close-up of giant tiger shrimp in Al Jibal Market in Sharjah, fresh seafood and creatures.
A meal with high nutritional value, a bunch of healthy, blonde dates, Deglet Nour dates, traditional Ramadan hospitality, luxurious types of dates in the Kingdom of Saudi Arabia, national local agricultural fruits and crops, white background
Traditional Ramadan hospitality, distinct types of dates, a meal with high nutritional value of blonde Saqqi dates isolated on a white background
Prawns, prawns, shrimp, fish market in the Deira area, seafood rich in protein, fresh seafood and marine organisms in the markets of the Emirate of Dubai, professional fishing in the United Arab Emirates, healthy and fresh fish, nutritional benefits of fish
Similar Vectors
View moreSimilar Vectors
Linear vector icons for different types of food, fish, chicken, meat, ready-made icons and templates, vector illustrator
Writing in authentic Arabic calligraphy, a logo for the name of a fish restaurant in Arabic, phrases and texts for oriental Arabic food, blue background, vector Illustrator
Local national agricultural products and crops, delicious fresh fruits, foods with high nutritional value, useful sugary dates, gray background, vector illustrator,
A plate of fresh healthy sugar dates with a glowing metal lantern, Saudi national local agricultural crops and products, delicious Ramadan hospitality, high nutritional value meal, delicious dates, white background, vector illustrator
Dates, brown Arabic manuscript, local national agricultural products and crops, delicious fresh fruits, high nutritional value food, healthy sugar dates, blue background, vector illustrator
Logo for fresh healthy sugar dates, a meal with high nutritional value, a local Saudi national agricultural product and crop, delicious Ramadan hospitality, delicious dates, white background, vector illustrator
Icons of fresh healthy sugar dates, a Saudi national local agricultural crop and product, a meal with high nutritional value, a delicious Ramadan hospitality, delicious dates, white background, vector illustrator
Chef's special attire, a welcoming gesture from the chef, a cartoon drawing of a smiling Arab chef presenting a steak on a plate in a professional manner, isolated, white background, vector illustration.
Similar Videos
View more
Keywords
healthyeasternpopularphotopictureseadecoratedrestaurantsdinnerfoodlunchmealrestaurantartisticdishcookingdeliciouskitcheneatingmealsbowldishespresentationvegetablescreaturesfastfoodsmethodsrichvesselspeciesfreshingredientsreciperecipeslifestyledietobjectstastytypesfattykitchenspiecemostappetizersappetizernutritionsaltymineralsproteinvitaminshealthy foodseafoodshrimpoysterskingdomsaudi arabiasauditraditionalarabicarrangedartartsdistinctivefast foodappetizinghealthy mealsmouldarab foodfast mealpresentation artseastern restaurantssystem fooddesirable dishesdesirable foodsassorted dishhuge dishmost typesvaried shapes
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.