A plate of grilled steak with vegetables, healthy lamb meals, delicious oriental Arabic cuisine, fast food restaurants, recipes and distinctive dishes in the kitchens of the Kingdom of Saudi Arabia
ID
219757
Seafood platter with most types of shrimp, oysters, etc., a meal with high nutritional value, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes of traditional popular Arab cuisine rich in proteins, delicious, healthy and tasty food recipes
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
A plate of grilled steak with vegetables, healthy lamb meals, delicious oriental Arabic cuisine, fast food restaurants, recipes and distinctive dishes in the kitchens of the Kingdom of Saudi Arabia
Seafood Risotto with Mussels and Shrimp, a highly nutritious meal, the art of presentation in restaurants and kitchens of the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Delicious scallops fried in a pan with balsamic sauce, a meal with high nutritional value, the arts of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and delicious food recipes
Delicious seafood, healthy popular meals and dishes, close-up of a plate of fish pieces with rice, vegetables and spices rich in flavors, traditional food recipes, food presentation arts in restaurants in the Kingdom of Saudi Arabia
Grilled scallops with creamy risotto, a meal with high nutritional value, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia, dishes from traditional popular Arab cuisine, delicious, healthy and tasty food recipes
Delicious Arabic food and meals, a meal with high nutritional value, a close-up photo of a plate of delicious lasagna with melted cheese, the art of presentation in restaurants and kitchens in the Kingdom of Saudi Arabia
Similar Photos
View moreSimilar Photos
Delicious sea oyster dish, mussels, aquatic shell animals, seafood, Arabic restaurants
Close-up of a plate of delicious shrimp depicted on a green background, a plate of seafood, delicious meals, chroma, delicious food, arabic restaurants, delicious seafood, recipes for delicious dishes
Plates of healthy dates, a meal with a high nutritional value, Ramadan hospitality, types of healthy and delicious dates, white background
A group of shrimp cups, seafood, seafood dishes, delicious meals, seafood restaurant, innovative presentation method
Close-up of grilled shrimp dish with potatoes, grilled dish, seafood, restaurants for oriental Arabic food, delicious meals, oriental Arabic food, seafood restaurants, black background
A meal with high nutritional value, a close-up of a healthy, blonde date, Deglet Nour dates, traditional Ramadan hospitality, distinct types of dates, white backgroun
Prawns, prawns, shrimp, fish market in the Deira area, seafood rich in protein, fresh seafood and marine organisms in the markets of the Emirate of Dubai, professional fishing in the United Arab Emirates, healthy and fresh fish, nutritional benefits of fish
Enjoy a healthy breakfast, delicious meals, a table of the most delicious foods in a high-end restaurant, delicious healthy dishes, restaurants serving Arabic and Western cuisine in the United Arab Emirates, foods with high nutritional value
Similar Vectors
View moreSimilar Vectors
Linear vector icons for different types of food, fish, chicken, meat, ready-made icons and templates, vector illustrator
Colorful fruit and vegetable icons, illustrations of fresh fruits and vegetables, food packages with high values, white background, vector Illustrator
Fresh healthy Sukkari dates, local Saudi national agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, date palms from the Kingdom of Saudi Arabia, white background, Vector Illustrator
Icons of fresh healthy sugar dates, a Saudi national local agricultural crop and product, a meal with high nutritional value, a delicious Ramadan hospitality, delicious dates, white background, vector illustrator
The joy of preparing delicious recipes, a cartoon of a veiled Saudi Arabian Gulf woman preparing salads, vegetables and healthy dishes, professional cooking, food presentation and decoration skills, vector illustrator
A plate of fresh healthy sugar dates with a copper kettle and cups, Saudi national local agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, delicious Saudi coffee, delicious dates, white background, vector illustrator
Saudi national local agricultural crop and product, veiled Saudi Arabian Gulf woman wearing abaya holding a plate of fresh healthy sugary dates, delicious Ramadan hospitality, high nutritional value meal, delicious dates, white background, vector illustrator
Similar Videos
View more
Keywords
healthyeasternpopularphotopictureseadecoratedrestaurantsdinnerfoodlunchmealrestaurantartisticdishcookingdeliciouskitcheneatingmealsbowldishespresentationvegetablescreaturesfastfoodsmethodsrichvesselspeciesfreshingredientsreciperecipeslifestyledietobjectstastytypesfattykitchenspiecemostappetizersappetizernutritionsaltymineralsproteinvitaminshealthy foodseafoodshrimpoysterskingdomsaudi arabiasauditraditionalarabicarrangedartartsdistinctivefast foodappetizinghealthy mealsmouldarab foodfast mealpresentation artseastern restaurantssystem fooddesirable dishesdesirable foodsassorted dishhuge dishmost typesvaried shapes
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.