Enjoying hot drinks with Eid sweets, traditional tea with delicious sweets, hospitality and generous reception in the Kingdom of Saudi Arabia, old Arab customs on holidays and occasions
ID
198236
A plate full of fresh fruits and nuts, light and healthy snacks rich in important nutrients, a Saudi breakfast, the art of presenting food and decorating in the oriental style, luxury restaurants in the Kingdom of Saudi Arabia
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
Enjoying hot drinks with Eid sweets, traditional tea with delicious sweets, hospitality and generous reception in the Kingdom of Saudi Arabia, old Arab customs on holidays and occasions
Oriental cuisine in Saudi Arabia restaurants, Oriental food recipes, image of a silver plate with a feast of appetizers, art of serving and preparing meals, concept of arranging and decorating food, healthy popular dishes
Oriental food recipes, setting the table for a festive Christmas dinner, oriental cuisine in Saudi Arabia restaurants, the art of serving and preparing meals, the concept of arranging and decorating food, healthy popular dishes
A feast of grilled food, delicious healthy food recipes, the art of presenting delicious oriental foods, traditional Arabic foods and dishes, a table full of grilled meats, protein-rich meals
Oriental cuisine in Saudi Arabia restaurants, Oriental food recipes, picture of a cheese plate with grapes, figs and nuts, the art of serving and preparing meals, the concept of arranging and decorating food, healthy popular dishes
Oriental food recipes, picture of grilled seafood and skewers on a silver plate, oriental food in Saudi Arabia restaurants, art of serving and preparing meals, concept of arranging and decorating food, healthy popular dishes
Similar Photos
View moreSimilar Photos
A Saudi man eats delicious fruit salad, a healthy diet, eating fresh fruits is good for health.
Cashew (Cashew) is a type of famous nuts, salted cashew, healthy and delicious nuts, a nutritional element beneficial to health, a snack, white background
Saudi national luxury local product, close-up of black fig fruit on a small wooden plate placed on a white table, delicious healthy tasty fruit with high benefits, agricultural crops rich in minerals and vitamins
Healthy and balanced food, portrait of an Arab Gulf Omani boy wearing a dishdasha and a kimono holding a banana in his hand and bringing it to his mouth, importance of the nutrients found in bananas, natural and fresh fruit, school snack, diet, full body, white background
School snack, importance of nutrients in bananas, healthy and balanced food, close-up portrait of an Arab Gulf Omani boy wearing a dishdasha and a kimono holding a banana looking at the camera with gestures of pleasure, fresh and natural fruit, diet, white background
The importance and benefits of fresh fruits for the skin, meeting the body's needs for essential nutrients, close-up portrait of a Saudi Arabian Gulf woman wearing an abaya, placing a white towel on her head, holding a green apple, following a healthy diet, delicious breakfast and snack, colorful background
Delicious snack, importance of nutrients in fruits, healthy and balanced food, portrait of a young Arab Gulf Omani man wearing a dishdasha and a kummah holding a pineapple and a banana looking at the camera with gestures of pleasure, diet, fresh and natural fruit, full body, white background
The importance of fresh fruits for the skin, meeting the body's need for nutrients, a close-up portrait of a Saudi Gulf Arab woman wearing casual attire with a white towel on her head holding slices of orange and a piece of cantaloupe in her hands, a delicious breakfast and snack, following a healthy diet, colorful background.
Similar Vectors
View moreSimilar Vectors
Vector cartoon character, a Gulf Arab woman who prepares food for family members, a cooker, Vector Illustrator.
A set of food icons, fresh fruits and vegetables, black line drawings and designs, white background, vector Illustrator
A plate of fresh healthy sugar dates with palm leaves, Saudi national local agricultural crops and products, delicious Ramadan hospitality, high nutritional value meal, delicious dates, white background, vector illustrator
Decorative metal bowl filled with healthy dates, high nutritional value meal, distinguished Ramadan hospitality, delicious healthy dates in Saudi Arabia, white background, vector illustrator
Islamic Food Date Icon Representing Traditional and Cultural Dietary Practice
Icons of fresh healthy sugar dates, a Saudi national local agricultural crop and product, a meal with high nutritional value, a delicious Ramadan hospitality, delicious dates, white background, vector illustrator
Saudi local product and crop, cartoon of two Saudi Arabian Gulf women wearing hijab carrying a plate full of vegetables and fruits, mosque background with domes and minarets, vector illustrator
Similar Videos
View more
Keywords
healthhealthyplateorientalwaymorninglightrestaurantskingdom of saudi arabiabreakfastfoodmealfruitsmealsmeatpresentingvegetablesfastalmondsnutsrichfreshfullcaloriestomatoescheesepistachiossnacksgrapesraisinsmineralsvitaminscashewsgreenskingdomsaudi arabiadecorationartarabiaoliveswalnutsapricotspeacheslight mealfast mealsdelicious appetizingimportant elementsimportant nutritional elementslight mealsluxury restaurantsoriental stylesaudi waystrengthens the body
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.