Seafood Tower with Oysters, Shrimp and Caviar
ID
198235
A plate full of fresh fruits and nuts, light and healthy snacks rich in important nutrients, a Saudi breakfast, the art of presenting food and decorating in the oriental style, luxury restaurants in the Kingdom of Saudi Arabia
Contributor
Important information
This content was generated by an Artificial Intelligence (AI) system
The photo may be unrealistic, Check License agreement
Categories
Same group
View moreSame group
Seafood Tower with Oysters, Shrimp and Caviar
Hospitality for holidays and occasions in the Kingdom of Saudi Arabia, an open buffet of delicious Arabic sweets, the art of presenting sweets in Arabic restaurants, foods rich in sugars and calories, a close-up photo of a table filled with delicious sweets, different and varied types and varieties of oriental sweets
Food presentation arts in Saudi kitchens and restaurants, delicious oriental Arabic dishes, interviews and varieties, healthy meals rich in protein, delicious seafood, presenting food in a modern and innovative way, close-up portrait of a large plate of shrimp and oysters
Food arrangement and decoration concept, healthy popular dessert, oriental food recipes, photo of a festive set of appetizers and desserts on golden plates, oriental food in Saudi Arabia restaurants, the art of serving and preparing meals
A plate full of grilled meats, traditional Arabic food and dishes, protein-rich meals, delicious healthy food recipes, the art of presenting delicious oriental foods, a plate decorated with a group of delicious grilled kebabs, restaurants in the Kingdom of Saudi Arabia
Eastern Arab food, a picture from the top of a plate of ripe fried falafel discs with fresh vegetables, popular food recipes in restaurants in the Kingdom of Saudi Arabia, a delicious breakfast,
Similar Photos
View moreSimilar Photos
Cashew (Cashew) is a type of famous nuts, salted cashew, healthy and delicious nuts, a nutritional element beneficial to health, a snack, white background
Cashew (Cashew) is a type of famous nuts, salted cashew, healthy and delicious nuts, a nutritional element beneficial to health, a snack, white background
A plate of healthy dates, Deglat Nour dates, a meal with a high nutritional value, Ramadan hospitality, healthy and delicious dates, a plate full of healthy sugary dates
Enjoying healthy food during school break, back to school season, portrait of a group of Saudi Arabian Gulf students wearing school uniforms sitting in their seats with lunch boxes in front of them, meals rich in important nutrients for body building, gray background
Healthy and balanced food, portrait of an Arab Gulf Omani boy wearing a dishdasha and a kimono holding a banana in his hand and bringing it to his mouth, importance of the nutrients found in bananas, natural and fresh fruit, school snack, diet, full body, white background
Importance of nutrients in bananas, healthy and balanced food, portrait of a young Arab Gulf Omani man wearing a dishdasha and a kimono holding a banana getting ready to eat it, diet, fresh and natural fruit, delicious snack, full body, white background
Natural and fresh fruit, the importance of the nutrients found in apples, healthy and balanced food, a portrait of a Saudi Gulf Arab student wearing traditional attire and a ghutrah, holding an apple with a backpack, following a diet, a delicious snack, full-body shot, white background.
Delicious cold desserts, a delicious healthy breakfast, the art of presenting desserts in restaurants in the Kingdom of Saudi Arabia, a plate of delicious crepe layers decorated with cream, honey and nuts, foods rich in sugars and calories
Similar Vectors
View moreSimilar Vectors
Fresh healthy fruit, fruits manuscript in Arabic inside apple fruit, delicious autumn fruits, white background, vector Illustrator
Fresh healthy Sukkari dates, local Saudi national agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, date palms from the Kingdom of Saudi Arabia, white background, Vector Illustrator
Date palm collection with fruits and leaves sketch vector illustration isolated.
A plate of fresh healthy sugar dates with a copper kettle and cups, Saudi national local agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, delicious Saudi coffee, delicious dates, white background, vector illustrator
Logo for fresh healthy sugar dates, a meal with high nutritional value, a local Saudi national agricultural product and crop, delicious Ramadan hospitality, delicious dates, white background, vector illustrator
Icon of a type of fresh healthy sugar dates, a Saudi national local agricultural crop and product, a meal with high nutritional value, a delicious Ramadan hospitality, delicious dates, white background, vector illustrator
A plate of fresh healthy sugar dates with a copper kettle and cups, Saudi national local agricultural crops and products, delicious Ramadan hospitality, a meal with high nutritional value, delicious Saudi coffee, delicious dates, white background, vector illustrator
Similar Videos
View more
Keywords
healthhealthyplateorientalwaymorninglightrestaurantskingdom of saudi arabiabreakfastfoodmealfruitsmealsmeatpresentingvegetablesfastalmondsnutsrichfreshfullcaloriestomatoescheesepistachiossnacksgrapesraisinsmineralsvitaminscashewsgreenskingdomsaudi arabiadecorationartarabiaoliveswalnutsapricotspeacheslight mealfast mealsdelicious appetizingimportant elementsimportant nutritional elementslight mealsluxury restaurantsoriental stylesaudi waystrengthens the body
Explore endless creative possibilities with our AI-powered image generator when you need more than what our library offers.
Generate using AI
We use cookies to provide for you a better experience. For more information check our Cookie policy.